Gene Rv1440
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in protein export. Participates in a early event of protein translocation. |
| Product | Probable protein-export membrane protein (translocase subunit) SecG |
| Comments | Rv1440, (MTCY493.14c), len: 77 aa. Probable secG, protein-export membrane protein (translocase subunit) (see citation below), similar to many e.g. P38388|SECG_MYCLE probable protein-export membrane (77 aa), FASTA scores: opt: 450, E(): 6.7e-24, (96.1% identity in 77 aa overlap). Start changed since original submission (-40 aa). Part of the prokaryotic protein translocation apparatus which comprise SECA|Rv3240c, SECD|Rv2587c, SECE|Rv0638, SECF|Rv2586c, SECG and SECY|Rv0732. |
| Functional category | Cell wall and cell processes |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1617837 | 1618070 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1440|secG
MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVTGIWLVSIIGVALLIKYR
Bibliography
- Braunstein M and Belisle JT [2000]. Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
