Gene ML0582c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable transaldolase Tal |
Comments | ML0582c, len: 375 aa. Probable tal, Transaldolase (EC 2.2.1.2), highly similar to TAL_MYCTU|O06812|Rv1448c tal, transaldolase from M. tuberculosis (373 aa), Fasta scores: E(): 7.9e-120, (78.9% identity in 370 aa overlap); and CAD96150|Mb1483c from M. bovis (373 aa). Highly similar to many e.g. O88018|TAL1_STRCO Transaldolase 1 from Streptomyces coelicolor (381 aa), fasta scores: E(): 2e-85, (61.983% identity in 363 aa overlap). Previously sequenced as TAL_MYCLE|P55193 (375 aa), Fasta scores: E(): 0, (100.0% identity in 375 aa overlap). Contains Pfam match to entry PF00923 Transaldolase, Transaldolase. Contains PS01054 Transaldolase signature 1. Contains PS00958 Transaldolase active site. Belongs to the Transaldolase family. |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 706462 | 707589 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0582c|tal MTSKIQNPNLAALSAAGVSVWLDDLSRDRLQSGNLQKLIDTKSVVGVTTNPSIFQKAFANGHAYDAQIAELAKRGANVDVTVRTVTTDDVRHACDVLACEWEASHGKDGRVSIEVDPRLAHDTDKTIAQAVELWRIVDHPNLFIKIPATKAGLPAITAVLAEGISVNVTLIFSVQRHREVIDAYLAGIEKAAEAGRDLSKIVSVASFFVSRVDTEIDKRLEKLGSEQALALRGQAGVANARLAYAAYQKAFEGGQRYQTLMARGAQVQRPLWASTGVKNPDYADTLYVTELVAPNTVNTMPETTIDAVADHGVIRGDTISGTTLSSQKVFDSLVAVGVDLIDVFAVLEHEGVQKFVKSWNELLKETQEQLDSVAK
Bibliography
No article yet recorded