Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionTransaldolase is important for the balance of metabolites in the pentose-phosphate pathway [catalytic activity: sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-erythrose 4-phosphate + D-fructose 6-phosphate]
ProductProbable transaldolase Tal
CommentsRv1448c, (MTCY493.06), len: 373 aa. Probable tal, Transaldolase, highly similar to many e.g. TAL_MYCLE|P55193 transaldolase from Mycobacterium leprae (375 aa), FASTA scores: opt: 1891, E(): 0, (78.6% identity in 370 aa overlap). Belongs to the transaldolase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS16269591628080-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1448c|tal
MTAQNPNLAALSAAGVSVWLDDLSRDRLRSGNLQELIDTKSVVGVTTNPSIFQKALSEGHTYDAQIAELAARGADVDATIRTVTTDDVRSACDVLVPQWEDSDGVDGRVSIEVDPRLAHETEKTIQQAIELWKIVDRPNLFIKIPATKAGLPAISAVLAEGISVNVTLIFSVQRYREVMDAYLTGMEKARQAGHSLSKIHSVASFFVSRVDTEIDKRLDRIGSRQALELRGQAGVANARLAYATYREVFEDSDRYRSLKVDGARVQRPLWASTGVKNPDYSDTLYVTELVAPHTVNTMPEKTIDAVADHGVIQGDTVTGTASDAQAVFDQLGAIGIDLTDVFAVLEEEGVRKFEASWNELLQETRAHLDTAAQ