Gene ML0614
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Possible conserved membrane protein |
Comments | ML0614, len: 95 aa. Possible conserved membrane protein, similar but longer at the N terminus to Rv2401A possible conserved membrane protein from M. tuberculosis (67 aa), E(): 1.9e-15, (67.692% identity in 65 aa overlap); and CAD97285|Mb2424c possible conserved membrane protein from M. bovis (67 aa), fasta scores: E(): 4.9e-14, (66.154% identity in 65 aa overlap). Previously sequenced as Q49760|U00016 (95 aa), Fasta scores: E(): 0, (100.0% identity in 95 aa overlap). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 747778 | 748065 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0614|ML0614 MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLAFVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG
Bibliography
No article yet recorded