Gene Rv2401A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane protein |
| Comments | Rv2401A, len: 67 aa. Possible conserved membrane protein, highly similar, but with 29 aa shorter, to ML0614|AL583919_34|Q49760 from Mycobacterium leprae (95 aa), FASTA scores: opt: 297, E(): 3.6e-15, (67.7% identity in 65 aa overlap). Has hydrophobic stretch. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2698042 | 2698245 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2401A|Rv2401A
VGPMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRARRPDQAPR
Bibliography
No article yet recorded