Gene ML0628
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0628, len: 178 aa. Conserved hypothetical protein, highly similar to YN67_MYCTU|O05831|Rv2367c Conserved hypothetical protein from M. tuberculosis (182 aa), Fasta scores: E(): 5.9e-67, (89.1% identity in 175 aa overlap); and CAD97249|Mb2388c from M. bovis (182 aa). Similar to many bacterial hypothetical proteins e.g. Q9L2L4|YP33_STRCO|AL136534|SCC117.06 hypothetical protein from Streptomyces coelicolor (165 aa), Fasta scores: E(): 1e-31, (54.5% identity in 154 aa overlap). Similar to O51806|AF000954 dgk, diacyglycerol kinase from Streptococcus mutans (164 aa), Fasta scores: E(): 3.8e-07, (30.9% identity in 162 aa overlap). Previously sequenced as YN67_MYCLE|Q49752 (178 aa), Fasta scores: E(): 0, (100.0% identity in 178 aa overlap). Contains Pfam match to entry PF02130 UPF0054, Uncharacterized protein family UPF0054. Contains PS01306 Uncharacterized protein family UPF0054 signature. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 761195 | 761731 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0628|ML0628
MSVEVSNESGFDVSEVELVSVARFVIIKMDVNPAAELSMVLLDTAAMADLHMRWMDLPGPTDVMSFPMDEFEPGGRPDAAEPGPSMLGDIVLCPEFAAQQAAAEGHSLGHELALLTIHGVLHLLGYDHGEPDEEKEMFALQGRLLEEWVAEQVRAYQHDRQNEKDCRLLYKSGYFGYL
Bibliography
No article yet recorded
