Gene Rv2367c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2367c, (MTCY27.13), len: 182 aa. Conserved hypothetical protein, equivalent to Q49752|YN67_MYCLE|ML0628|B1937_F1_21 hypothetical 19.8 KDA protein from Mycobacterium leprae (178 aa), FASTA scores: opt: 1051, E(): 2e-59, (89.1% identity in 175 aa overlap). Also highly similar to others e.g. Q9L2L4|SCC117.06 conserved hypothetical protein from Streptomyces coelicolor (165 aa), FASTA scores: opt: 599, E(): 6e-31, (56.5% identity in 154 aa overlap); Q9KD56|BH1363 hypothetical protein from Bacillus halodurans (159 aa), FASTA scores: opt: 311, E(): 8.3e-13, (45.05% identity in 111 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2648364 | 2648912 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2367c|Rv2367c
VREHLMSIEVANESGIDVSEAELVSVARFVIAKMDVNPCAELSMLLLDTAAMADLHMRWMDLPGPTDVMSFPMDELEPGGRPDAPEPGPSMLGDIVLCPEFAAEQAAAAGHSLGHELALLTIHGVLHLLGYDHAEPDEEKEMFALQDRLLEEWVADQVEAYQHDRQDEKDRRLLDKSRYFDL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant