Gene ML0633
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable DNA repair protein RecO |
| Comments | ML0633, len: 268 aa. Probable DNA repair protein recO (Recombination protein O), highly similar to O05836|AL123456|Rv2362c Probable DNA repair protein recO from M. tuberculosis (265 aa), Fasta scores: E(): 1.1e-98, (86.6% identity in 268 aa overlap); and CAD97244|Mb2383c from M. bovis. Similar to others e.g. Q9L2H3|RECO_STRCO DNA repair protein recO from Streptomyces coelicolor (251 aa), Fasta scores: E(): 9.6e-50, (52.8% identity in 248 aa overlap). Shows weak similarity, except at C-terminus to RECO_BACSU|P42095 recO, DNA repair protein from Bacillus subtilis (255 aa), Fasta scores: E(): 5.3e-11, (27.3% identity in 176 aa overlap). Previously sequenced as Q49754|U00016 (269 aa), Fasta scores: E(): 0, (100.0% identity in 268 aa overlap). Contain a Pfam match to PF02565; RecO. BELONGS TO THE RECO FAMILY. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 765912 | 766718 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0633|recO
MRLYRDWALVLRQHNLGEADRIVTLLTRDHGLVRAVAKGVRRTRSKFGARLEPFAYIDAQLHPGRNLDIVTQVVSIDAFATDIVSDYGRYTCGCAMLETAERLAGEERAPAPTLHRLTVSALRAVADGNRPRDLLLDAYLLRAMGIAGWAPALTACARCATPGPHRAFHIAAGGSVCVHCRPAGSTTPPRGVLELMSALHDGDWGTAQQAPQSHRSYASGLVAAHLQWHLERQLKTLPLVERTHQAYQVDRSIAERRAALVRQDMACG
Bibliography
No article yet recorded
