Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in DNA repair and RECF pathway recombination
ProductPossible DNA repair protein RecO
CommentsRv2362c, (MTCY27.18), len: 265 aa. RecO, DNA repair protein, equivalent to Q9CCN0|ML0633 Mycobacterium leprae Hypothetical protein (268 aa), FASTA scores: opt: 1560, E(): 8.5e-93, (86.6% identity in 268 aa overlap). Also highly similar to others e.g. Q9L2H3|SCC121.13c DNA repair protein recO from Streptomyces coelicolor (251 aa), FASTA scores: opt: 843, E(): 6.9e-47, (52.2% identity in 249 aa overlap); and similar to other hypothetical proteins. Weak similarity with P42095|RECO_BACSU DNA repair protein recombinase from Bacillus subtilis (255 aa), FASTA scores: opt: 270, E(): 3.6e-10, (26.4% identity in 182 aa overlap). Maybe involved in modulating assembly and disassembly of RECA filaments (with RECF|Rv0003 and RECR|Rv3715c) (see citation below). Contains match to Pfam entry PF02565 Recombination protein O. Belongs to the RECO family.
Functional categoryInformation pathways
ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene domain for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS26434612644258-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2362c|recO
MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTRSKFGARLEPFAHIEVQLHPGRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERLAGEERAPAPALHRLTVGALRAVADGQRPRDLLLDAYLLRAMGIAGWAPALTECARCATPGPHRAFHIATGGSVCAHCRPAGSTTPPLGVVDLMSALYDGDWEAAEAAPQSARSHVSGLVAAHLQWHLERQLKTLPLVERFYQADRSVAERRAALIGQDIAGG