Gene Rv2362c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in DNA repair and RECF pathway recombination |
| Product | Possible DNA repair protein RecO |
| Comments | Rv2362c, (MTCY27.18), len: 265 aa. RecO, DNA repair protein, equivalent to Q9CCN0|ML0633 Mycobacterium leprae Hypothetical protein (268 aa), FASTA scores: opt: 1560, E(): 8.5e-93, (86.6% identity in 268 aa overlap). Also highly similar to others e.g. Q9L2H3|SCC121.13c DNA repair protein recO from Streptomyces coelicolor (251 aa), FASTA scores: opt: 843, E(): 6.9e-47, (52.2% identity in 249 aa overlap); and similar to other hypothetical proteins. Weak similarity with P42095|RECO_BACSU DNA repair protein recombinase from Bacillus subtilis (255 aa), FASTA scores: opt: 270, E(): 3.6e-10, (26.4% identity in 182 aa overlap). Maybe involved in modulating assembly and disassembly of RECA filaments (with RECF|Rv0003 and RECR|Rv3715c) (see citation below). Contains match to Pfam entry PF02565 Recombination protein O. Belongs to the RECO family. |
| Functional category | Information pathways |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene domain for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2643461 | 2644258 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2362c|recO
MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTRSKFGARLEPFAHIEVQLHPGRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERLAGEERAPAPALHRLTVGALRAVADGQRPRDLLLDAYLLRAMGIAGWAPALTECARCATPGPHRAFHIATGGSVCAHCRPAGSTTPPLGVVDLMSALYDGDWEAAEAAPQSARSHVSGLVAAHLQWHLERQLKTLPLVERFYQADRSVAERRAALIGQDIAGG
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
