Gene ML0675
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable integral membrane protein |
Comments | ML0675, len: 91 aa. Probable integral membrane protein highly similar to O50384|AL123456|Rv3355c Probable integral membrane protein from M. tuberculosis (97 aa), Fasta scores: E(): 1.2e-24, (77.9% identity in 95 aa overlap); and CAD95535|Mb3390c from M. bovis (97 aa). Also similar to O50377|Rv3346c Hypothetical protein from M. tuberculosis (85 aa), fasta scores: E(): 5.2e-18, (68.421% identity in 95 aa overlap). Previously sequenced as O32878|Z98271 (91 aa), Fasta scores: E(): 0, (98.9% identity in 91 aa overlap). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 811544 | 811819 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0675|ML0675 VRAALRSQWPILLVGMIFAGAFVLVGANFWRRGALLIGIGVGVATVLRLVLSDERAGLLMVRGKVIDLVTTALVGMAMVYIASTIDPLGTG
Bibliography
No article yet recorded