Gene Rv3355c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Probable integral membrane protein |
| Comments | Rv3355c, (MTV004.12c), len: 97 aa. Probable integral membrane protein, equivalent to O32878|MLCB1779.16c|ML0675 hypothetical 9.6 KDA protein from Mycobacterium leprae (91 aa), FASTA scores: opt: 439, E(): 3.9e-23, (78.9% identity in 90 aa overlap). Identical, but with a gap, to O50377|Rv3346c|MTV004.02c hypothetical 8.9 KDA protein from Mycobacterium tuberculosis (85 aa), FASTA scores: opt: 413, E(): 2.1e-21, (85.55% identity in 97 aa overlap). Also some similarity to other proteins e.g. Q9K3J5|SC2A6.10 putative integral membrane protein from Streptomyces coelicolor (178 aa), FASTA scores: opt: 147, E(): 0.003, (31.25% identity in 80 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3769514 | 3769807 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3355c|Rv3355c
MTVRAVFRRTVGAQWPILLVGSIFAVGFVLAGANFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
