Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductProbable integral membrane protein
CommentsRv3355c, (MTV004.12c), len: 97 aa. Probable integral membrane protein, equivalent to O32878|MLCB1779.16c|ML0675 hypothetical 9.6 KDA protein from Mycobacterium leprae (91 aa), FASTA scores: opt: 439, E(): 3.9e-23, (78.9% identity in 90 aa overlap). Identical, but with a gap, to O50377|Rv3346c|MTV004.02c hypothetical 8.9 KDA protein from Mycobacterium tuberculosis (85 aa), FASTA scores: opt: 413, E(): 2.1e-21, (85.55% identity in 97 aa overlap). Also some similarity to other proteins e.g. Q9K3J5|SC2A6.10 putative integral membrane protein from Streptomyces coelicolor (178 aa), FASTA scores: opt: 147, E(): 0.003, (31.25% identity in 80 aa overlap).
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37695143769807-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3355c|Rv3355c
MTVRAVFRRTVGAQWPILLVGSIFAVGFVLAGANFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG