Gene ML0698c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable succinate dehydrogenase (hydrophobic membrane anchor protein) SdhD (SUCCINIC DEHYDROGENASE) (FUMARATE REDUCTASE) (FUMARATE DEHYDROGENASE) (FUMARIC HYDROGENASE) |
Comments | ML0698c, len: 163 aa. Probable sdhD, membrane anchor of succinate dehydrogenase SdhD subunit (EC 1.3.99.1), highly similar to O53369|AL123456|Rv3317 sdhD, putative membrane anchor of succinate dehydrogenase from M. tuberculosis (144 aa), Fasta scores: E(): 0, (85.2% identity in 142 aa overlap); and CAD95438|Mb3346 from M. bovis (144 aa). Similar to several e.g. Q9KZ89 Putative succinate dehydrogenase membrane subunit from Streptomyces coelicolor (160 aa), fasta scores: E(): 1.6e-29, (50.968% identity in 155 aa overlap). Previously sequenced as Q49915|U00022 (163 aa), Fasta scores: E(): 0, (100.0% identity in 163 aa overlap). Contains hydrophobic, possible membrane-spanning regions. PART OF AN ENZYME COMPLEX CONTAINING FOUR SUBUNITS: A FLAVOPROTEIN, AN IRON-SULFUR, CYTOCHROME B-556, AND AN HYDROPHOBIC ANCHOR PROTEIN. |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 836442 | 836933 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
>Mycobacterium leprae TN|CDS|ML0698c|836442-836933|-|sdhD|downstream:0|upstream:0 atgagcaactccgatcttcagctcagacctcaagttcaacctacatgccaaaaaggccagttagccccggtgcggcagcgcagctacgaccgccccgcaagcttagacaaccctcgttcaccgcgtcgacgcgccggcatccccaacttcgaaaagttcgcctggctgttcatgcggttctcgggtgtcgcgctggtggtactggcgttcgggcacttattcatcatgctgatgtgggacaacggcgtgtaccgcatcgacttcaactttgtggcgcagcgctggtcttcaccgttctggcgattctgggacctggcactactgtggctggcgcaagtccacggcggcaacggcttgcgcaacatcatcgacgactacagccgcaaagaccacacgcggttctggctcaatagcttgctgctgttgtcaatggggttcacgctggtgctgggcagctacgtgctgttgtcattcgatcccaacatctcctga
Protein sequence
>Mycobacterium leprae TN|ML0698c|sdhD MSNSDLQLRPQVQPTCQKGQLAPVRQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGVALVVLAFGHLFIMLMWDNGVYRIDFNFVAQRWSSPFWRFWDLALLWLAQVHGGNGLRNIIDDYSRKDHTRFWLNSLLLLSMGFTLVLGSYVLLSFDPNIS
Bibliography
No article yet recorded