Gene Rv3317
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Involved in tricarboxylic acid cycle. Putative hydrophobic component of the succinate dehydrogenase complex. Could be required to anchor the catalytic components to the cytoplasmic membrane |
Product | Probable succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD (succinic dehydrogenase) (fumarate reductase) (fumarate dehydrogenase) (fumaric hydrogenase) |
Comments | Rv3317, (MTV016.17), len: 144 aa. Probable sdhD, membrane anchor of succinate dehydrogenase SdhD subunit , equivalent (but shorter 19 aa) to Q49915|SDHD|ML0698|L308_F1_25 putative succinate dehydrogenase hydrophobic membrane anchor protein from Mycobacterium leprae (163 aa), FASTA scores: opt: 878, E(): 1.9e-51, (85.2% identity in 142 aa overlap). Also similar to others e.g. Q9KZ89|SC5G8.25c from Streptomyces coelicolor (160 aa), FASTA scores: opt: 553, E(): 6.6e-30, (58.85% identity in 141 aa overlap); Q9RVR9|DR0953 from Deinococcus radiodurans (125 aa), FASTA scores: opt: 251, E(): 5.5e-10, (37.15% identity in 113 aa overlap); O29573|DHSD_ARCFU|SDHD|AF0684 from Archaeoglobus fulgidus (117 aa), FASTA scores: opt: 160, E(): 0.00056, (25.95% identity in 108 aa overlap); etc. Part of an enzyme complex containing four subunits: a flavoprotein, an iron-sulfur, cytochrome B-556, and an hydrophobic anchor protein. |
Functional category | Intermediary metabolism and respiration |
Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3704437 | 3704871 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3317|sdhD MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHVFIMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSLLVLSMLFTLMLGTYVIVTFDPNIS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant