Gene ML0700
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable adenosine deaminase Add (ADENOSINE AMINOHYDROLASE) |
| Comments | ML0700, len: 362 aa. Probable add, adenosine deaminase (EC 3.5.4.4), highlt similar to O53365|AL123456|Rv3313c add, probable adenosine deaminase from M. tuberculosis (365 aa), Fasta scores: E(): 0, (88.2% identity in 356 aa overlap). Similar to many e.g. Q9AK25|ADD5_STRCO Probable adenosine deaminase 5 from Streptomyces coelicolor (396 aa), fasta scores: E(): 9.9e-99, 66.856% identity in 353 aa overlap); and ADD_ECOLI|P22333 add, adenosine deaminase from Escherichia coli (333 aa), Fasta scores: E(): 6.8e-19, (29.7% identity in 340 aa overlap). Previously sequenced as Q49907|U00022 (332 aa), Fasta scores: E(): 0, (99.7% identity in 332 aa overlap). Contains Pfam match to entry PF00962 A_deaminase, Adenosine/AMP deaminase. BELONGS TO THE ADENOSINE AND AMP DEAMINASES FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 837680 | 838768 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0700|add
MNTPLHLENIKQAPKALLHDHLDGGLRPATVLDIAGQVGYDRLPATDVESLETWFRTASHSGSLERYLEPFSHTVAVMQTPEALHRVAYECVEDLAADSVVYAEVRFAPELHIDEGLSFDEVLASVLAGFADGERACAAEGNAITVRCLVTAMRHAAMSREIAELAIRFRDKGVVGFDIAGAEAGHPPTRHLDAFEYMRSNNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDVDPGGGIRLGPLASILRDKRIPLELCPSSNLQTGAVASITEHPFDLLAWARFRVTVNTDNRLMSDTSMSLEMHRLVEAFGYGWGDLERFTINAMKSAFIPFDQRLAIIDEVIKPRFAVLVG
Bibliography
No article yet recorded
