Gene Rv3313c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Catalyzes hydrolytic deamination of adenosine and generates inosine [catalytic activity: adenosine + H(2)O = inosine + NH(3) (also may act on deoxyadenosine)]. |
| Product | Probable adenosine deaminase Add (adenosine aminohydrolase) |
| Comments | Rv3313c, (MTV016.13), len: 365 aa. Probable add, adenosine deaminase, equivalent to Q9CCL9|add|ML0700 putative adenosine deaminase from Mycobacterium leprae (362 aa), FASTA scores: opt: 2097, E(): 1.4e-127, (88.2% identity in 356 aa overlap). Also similar to many e.g. Q9AK25|2SCK8.27 from Streptomyces coelicolor (396 aa), FASTA scores: opt: 1578, E(): 3.7e-94, (66.65% identity in 360 aa overlap); Q17747|C06G3.5 from Caenorhabditis elegans (349 aa), FASTA scores: opt: 435, E(): 1.1e-20, (29.6% identity in 348 aa overlap); P22333|ADD_ECOLI|B1623 from Escherichia coli strain K12 (333 aa), FASTA scores: opt: 380, E(): 3.7e-17, (29.4% identity in 340 aa overlap); etc. Belongs to the adenosine and AMP deaminases family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3701087 | 3702184 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3313c|add
MTAAPTLQTIRLAPKALLHDHLDGGLRPATVLDIAGQVGYDDLPATDVDALASWFRTQSHSGSLERYLEPFSHTVAVMQTPEALYRVAFECAQDLAADSVVYAEVRFAPELHISCGLSFDDVVDTVLTGFAAGEKACAADGQPITVRCLVTAMRHAAMSREIAELAIRFRDKGVVGFDIAGAEAGHPPTRHLDAFEYMRDHNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDVDADGGFQLGRLAAILRDKRIPLELCPSSNVQTGAVASIAEHPFDLLARARFRVTVNTDNRLMSDTSMSLEMHRLVEAFGYGWSDLARFTVNAMKSAFIPFDQRLAIIDEVIKPRFAALMGHSE
Bibliography
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
