Gene ML0729c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0729c, len: 213 aa. Conserved hypothetical protein, similar to P96887|AL123456|Rv3282 conserved hypothetical protein from M. tuberculosis (222 aa), Fasta scores: E(): 2.7e-57, (68.5% identity in 213 aa overlap); and CAD95402| from M. bovis (222 aa). Similar to maf-family proteins and other hypothetical proteins e.g. MAF_BACSU|Q02169 maf, protein involved in septum formation from Bacillus subtilis (189 aa), Fasta scores: E(): 4.8e-08, (29.1% identity in 196 aa overlap). Also similar to the N-terminal half of O95671|Y15521 asmtl, acetylserotonin methytransferase-like gene from Homo sapiens (629 aa), Fasta scores: E(): 2.1e-09, (31.6% identity in 193 aa overlap). Previously sequenced as Q49670|U00012 (213 aa), Fasta scores: E(): 0, (100.0% identity in 213 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 871120 | 871761 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0729c|ML0729c
MTRLVLGSASAGRLKVLRQAGIDPLVAASGVDEDLVTAGLGSDTSPRDVVSTLARAKATQVAAALSHAVADDCVVISCDSQLSIDGRLYGKPQSVANARQQWQSMAGRAGQLYTGHCVIRLLNNETTYSVDETSMTTICFGNPSAEDLEAYLACGESLQVAGGFTLDGLGGWFIDAVYGDPSTVVGIGLPLTRSLLSRAGLSIAAMWAANPVI
Bibliography
No article yet recorded