Gene Rv3282
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3282, (MTCY71.22), len: 222 aa. Conserved hypothetical protein, equivalent to Q49670|ML0729 1308R (hypothetical protein ML0729) from Mycobacterium leprae (213 aa), FASTA scores: opt: 945, E(): 5.5e-54, (68.55% identity in 213 aa overlap). Also similar to Q9EWV6|2SCK31.18 conserved hypothetical protein from Streptomyces coelicolor (206 aa), FASTA scores: opt: 459, E(): 1.3e-22, (47.35% identity in 209 aa overlap); P74331|MAF or SLL0905 MAF protein from Synechocystis sp. strain PCC 6803 (195 aa), FASTA scores: opt: 401, E(): 6.9e-19, (43.0% identity in 207 aa overlap); and shows weak similarity with various proteins e.g. Q9BUL6 acetylserotonin O-methyltransferase-like from Homo sapiens (Human) (621 aa), FASTA scores: opt: 282, E(): 8.9e-11, (31.6% identity in 193 aa overlap); O95671|ASMTL ASMTL protein from Homo sapiens (Human) (629 aa), FASTA scores: opt: 282, E(): 9e-11, (31.6% identity in 193 aa overlap); BAB51136|MLR4491 MAF protein from Rhizobium loti (Mesorhizobium loti) (199 aa), FASTA scores: opt: 269, E(): 2.3e-10, (29.3% identity in 198 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3664219 | 3664887 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3282|Rv3282
MTRLVLGSASPGRLKVLRDAGIEPLVIASHVDEDVVIAALGPDAVPSDVVCVLAAAKAAQVATTLTGTQRIVAADCVVVACDSMLYIEGRLLGKPASIDEAREQWRSMAGRAGQLYTGHGVIRLQDNKTVYRAAETAITTVYFGTPSASDLEAYLASGESLRVAGGFTLDGLGGWFIDGVQGNPSNVIGLSLPLLRSLVQRCGLSVAALWAGNAGGPAHKQQ
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
