Gene ML0730c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0730c, len: 84 aa. Conserved hypothetical protein, similar to Rv3281|MTCY71.21|P96886|Z92771 Conserved hypothetical protein from Mycobacterium tuberculosis (177 aa) fasta scores: E(): 2.4e-22, (69.0% identity in 87 aa); and CAD95401|Mb3309 from M. bovis (156 aa). Previously sequenced as Q49671|U00012. Contains Pfam match to entry PF01039 Carboxyl_trans, Carboxyl transferase domain. |
| Functional category | Conserved hypotheticals, Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 871758 | 872012 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0730c|ML0730c
VSAANDGSETNKLPTTQNPHIQITKGQPTDQELAALIVVLSSIGGASQVKQPEPTRWGLPVDKLRYPVFSWQRITLHEMTHMRR
Bibliography
No article yet recorded