Gene Rv3281
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in long-chain fatty acid synthesis |
| Product | Probable bifunctional protein acetyl-/propionyl-coenzyme A carboxylase (epsilon chain) AccE5 |
| Comments | Rv3281, (MTCY71.21), len: 177 aa. Probable accE5, bifunctional acetyl-/propionyl-coenzyme A carboxylase, epsilon chain, equivalent (but longer 14 aa and with a gap between aa 82-102) to AAK47723|MT3380 from Mycobacterium tuberculosis strain CDC1551 (142 aa), FASTA scores: opt: 830, E(): 3.1e-40, (86.5% identity in 163 aa overlap). C-terminus highly similar to Q49671|B1308_C3_211|ML0730 from Mycobacterium leprae (84 aa), FASTA scores: opt: 393, E(): 7.6e-16, (68.95% identity in 87 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). AccA3 (Rv3285), AccD5 (Rv3280), AccD4 (Rv3799), and AccE5 (Rv3281) form a biotin-dependent acyl-CoA carboxylase in M. tuberculosis H37Rv (See Oh et al., 2006). |
| Functional category | Lipid metabolism |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis and possibly down-regulated by hrcA|Rv2374c (see citation below). |
| Operon | Rv3280 and Rv3281 are co-transcribed, by RT-PCR (See Oh et al., 2006). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3663689 | 3664222 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3281|accE5
MGTCPCESSERNEPVSRVSGTNEVSDGNETNNPAEVSDGNETNNPAEVSDGNETNNPAPVSRVSGTNEVSDGNETNNPAPVSRVSGTNEVSDGNETNNPAPVTEKPLHPHEPHIEILRGQPTDQELAALIAVLGSISGSTPPAQPEPTRWGLPVDQLRYPVFSWQRITLQEMTHMRR
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Oh TJ et al. [2006]. Identification and characterization of Rv3281 as a novel subunit of a biotin-dependent acyl-CoA Carboxylase in Mycobacterium tuberculosis H37Rv. Function Operon Product
- Gago G et al. [2006]. Biochemical and structural characterization of an essential acyl coenzyme A carboxylase from Mycobacterium tuberculosis. Function Product
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant