Gene ML0748c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | ML0748c, len: 92 aa. Conserved hypothetical protein, highly similar to Rv3269|MTCY71.09|P96874|Z92771 Conserved hypothetical protein from M. tuberculosis (93 aa) fasta scores: E(): 5.5e-23, (73.6% identity in 91 aa), CAD95389| from M. bovis (93 aa). Similar to many Mycobacterium proteins and chaperonins/heat shock proteins e.g. Rv1993c|MTCY39.26|YJ93_MYCTU|Q10865 hypothetical protein from M. tuberculosis (90 aa), fasta scores: E(): 6.3e-14, (60.8% identity in 79 aa) and Rv0968|MTCY10D7.06c|Y968_MYCTU|P71542 hypothetical protein from M. tuberculosis (98 aa), fasta scores:E(): 4.4e-11, (52.1% identity in 96 aa). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 890982 | 891260 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0748c|ML0748c MVQGLLAKAATMVITGLTGVTAYEMLRKAVTKVPLHQIAVSALELGLRGSRKAEEAAESARLKLADVMAEARERIGKETTAPAVSDIHQHDH
Bibliography
No article yet recorded