Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown. May be involved in a chaperoning process.
ProductConserved protein
CommentsRv3269, (MTCY71.09), len: 93 aa. Conserved protein, similar to many Mycobacterium proteins and chaperonins/heat shock proteins e.g. Q9CCL0|ML0748 hypothetical protein from Mycobacterium leprae (92 aa), FASTA scores: opt: 427, E(): 6.8e-21, (73.65% identity in 91 aa overlap); Q10865|Rv1993c|MT2049|MTCY39.26c hypothetical protein from Mycobacterium tuberculosis (90 aa), FASTA scores: opt: 313, E(): 1.2e-13, (60.7% identity in 84 aa overlap); P71542|Y968_MYCTU|Rv0968|MTCY10D7.06c (98 aa), FASTA scores: opt: 294, E(): 2.2e-12, (55.1% identity in 98 aa overlap); Q50827|MOPA|GROEL|CH60_MYCVA chaperonin (protein CPN60) from Mycobacterium vaccae (120 aa), FASTA scores: opt: 107, E(): 2.1, (39.5% identity in 81 aa overlap); Q9AEB3|HSP65 heat shock protein (fragment) from Mycobacterium gadium (122 aa), FASTA scores: opt: 102, E(): 4.4, (38.25% identity in 81 aa overlap); Q49374|CH60_MYCGN|MOPA|GROEL chaperonin (protein CPN60) from Mycobacterium genavense (120 aa), FASTA scores: opt: 99, E(): 6.8, (40.25% identity in 82 aa overlap); etc. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryVirulence, detoxification, adaptation
ProteomicsIdentified by proteomics (See Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsDNA microarrays show higher level of expression in M. tuberculosis H37Rv during Mg2+ starvation (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36502343650515+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3269|Rv3269
MAIQVFLAKATTTVITGLAGVTAYEILKKAAAKAPLRQTAVSAAALGLRGTRKAEEAAESARLKVADVMAEARERIGEESPTPAISDLHDHDH
      
Bibliography