Gene Rv3269
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown. May be involved in a chaperoning process. |
| Product | Conserved protein |
| Comments | Rv3269, (MTCY71.09), len: 93 aa. Conserved protein, similar to many Mycobacterium proteins and chaperonins/heat shock proteins e.g. Q9CCL0|ML0748 hypothetical protein from Mycobacterium leprae (92 aa), FASTA scores: opt: 427, E(): 6.8e-21, (73.65% identity in 91 aa overlap); Q10865|Rv1993c|MT2049|MTCY39.26c hypothetical protein from Mycobacterium tuberculosis (90 aa), FASTA scores: opt: 313, E(): 1.2e-13, (60.7% identity in 84 aa overlap); P71542|Y968_MYCTU|Rv0968|MTCY10D7.06c (98 aa), FASTA scores: opt: 294, E(): 2.2e-12, (55.1% identity in 98 aa overlap); Q50827|MOPA|GROEL|CH60_MYCVA chaperonin (protein CPN60) from Mycobacterium vaccae (120 aa), FASTA scores: opt: 107, E(): 2.1, (39.5% identity in 81 aa overlap); Q9AEB3|HSP65 heat shock protein (fragment) from Mycobacterium gadium (122 aa), FASTA scores: opt: 102, E(): 4.4, (38.25% identity in 81 aa overlap); Q49374|CH60_MYCGN|MOPA|GROEL chaperonin (protein CPN60) from Mycobacterium genavense (120 aa), FASTA scores: opt: 99, E(): 6.8, (40.25% identity in 82 aa overlap); etc. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | - |
| Proteomics | Identified by proteomics (See Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Transcriptomics | DNA microarrays show higher level of expression in M. tuberculosis H37Rv during Mg2+ starvation (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3650234 | 3650515 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3269|Rv3269
MAIQVFLAKATTTVITGLAGVTAYEILKKAAAKAPLRQTAVSAAALGLRGTRKAEEAAESARLKVADVMAEARERIGEESPTPAISDLHDHDH
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant