Gene ML0761c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | ML0761c, len: 167 aa. Conserved hypothetical protein, highly similar but longer than Rv3259|MTV015.04|O53352|AL021840 Conserved hypothetical protein from Mycobacterium tuberculosis (139 aa), fasta scores: E(): 6.9e-56, (89.2% identity in 139 aa); and CAD95379| from M. bovis (139 aa). Also similar to Q9S425|AF164439 hypothetical 6.0 kDa protein (partial CDS) from Mycobacterium smegmatis (54 aa), fasta scores: E(): 1e-10, (75.5% identity in 53 aa); and Q9KZL3 Hypothetical protein SCO3031 from Streptomyces coelicolor (117 aa), FASTA scores: E(): 0.012, (30.159% identity in 126 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 903526 | 904029 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0761c|ML0761c VSNSCSSSRHGQWSRRFSSRRAAKRGRDIRGPLLPPTVPGWRSRAERFDMAVLEAYEPIEQRWQGRVSELDVAVDEIPRIAARNPENVQWPPEVIADGPIALARLIPAGVDVRSNATRARIVLFRKPIERRAHDTVELGELLHDILVAQVAIYLDVEPSAIDPTMDD
Bibliography
No article yet recorded