Gene Rv3259
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3259, (MTV015.04), len: 139 aa. Conserved hypothetical protein, equivalent, but shorter 29 aa, to Q9CCJ9|ML0761 hypothetical protein from Mycobacterium leprae (167 aa), FASTA scores: opt: 846, E(): 2.2e-47, (89.2% identity in 139 aa overlap). C-terminus highly similar to Q9S425 hypothetical 6.0 KDA protein (fragment) from Mycobacterium smegmatis (54 aa), FASTA scores: opt: 275, E(): 2.7e-11, (81.15% identity in 53 aa overlap). Also similar to Q9KZL3|SCE34.12 from Streptomyces coelicolor (117 aa), FASTA scores: opt: 152, E(): 0.004, (34.15% identity in 126 aa overlap). Equivalent to AAK47699 from Mycobacterium tuberculosis strain CDC1551 (175 aa) but shorter 36 aa. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3639425 | 3639844 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3259|Rv3259
MRGPLLPPTVPGWRSRAERFDMAVLEAYEPIERRWQERVSQLDIAVDEIPRIAAKDPESVQWPPEVIADGPIALARLIPAGVDVRGNATRARIVLFRKPIERRAKDTEELGELLHEILVAQVAIYLDVDPSVIDPTIDD
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
