Gene ML0778
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0778, len: 229 aa. Conserved hypothetical protein, similar to many hypothetical proteins and to some putative ribosomal proteins e.g. Rv3241c|MTCY20B11.16c|O05886|Z95121 Conserved hypothetical protein from Mycobacterium tuberculosis (213 aa), fasta scores: E(): 4.4e-79, (89.3% identity in 206 aa); and RR30_SPIOL|P19954 30s ribosomal protein S30, chloroplast precursor RPS30 from Spinacia oleracea (302 aa), fasta scores: E(): 1.3e-10, (26.8% identity in 213 aa). |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 920954 | 921643 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0778|ML0778
MSRLTVGFGQVLNSAPVPSDEQVEPMPNVEIVFKGRNVEIPDHFRIHVSQRLARLERFDRTIYLFDVELDHERNRRQRKFCQRVEITARGRGPVVRGEACADSFYAALESAVVKLESRLRRGKDRRKVHYGDKTPVSVAEATAVAVSPEKAFNTEPAPAHDHGGAVTDYEPGRIVRTKEHPAKPMSVDDALYEMELVGHDFFLFLDKQSERPSVVYRRHAYDYGLIRLA
Bibliography
No article yet recorded