Gene ML0793
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0793, len: 252 aa. Conserved hypothetical protein, highly similar to Rv3226c|MTCY20B11.01c|O05872|Z95121 Conserved hypothetical protein from M. tuberculosis (252 aa), fasta scores: E(): 7.5e-76, (70.6% identity in 252 aa); and CAD95347| from M. bovis (252 aa). Similar to various hypothetical bacterial proteins e.g. O64131|AF020713 yoqW protein from Bacteriophage SPBc2 (224 aa), fasta scores: E(): 4.8e-21, (36.5% identity in 244 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 936848 | 937606 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0793|ML0793
MAGVCGRFAVITSTALLAEKIKAVDEATVDAPNYNVAPTVPIATVVSRHSESDYEPTRRVRLMRWGLIPPWIKASSDGGPDIKGPLLINVRADKVATSPVFRNSAKSKRCLVPMDGWYEWQVNVDSALGKKASTTPFFINRDDGATLFMAGLWSVWQPANSSAMLLSCTIITTDAVGELAEIHDRMPLILAEYDWDVWLNPYIPLDPQLLARSPDVHDIDVRPVSTLVNSVRNNGPELLEPVLLQPGQITLL
Bibliography
No article yet recorded