Gene Rv3226c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3226c, (MTCY20B11.01c), len: 252 aa. Conserved hypothetical protein, similar to various hypothetical bacterial proteins e.g. Q9CCI2|ML0793 putative bacteriophage protein from Mycobacterium leprae (252 aa), FASTA scores: opt: 1183, E(): 3.8e-68, (70.65% identity in 252 aa overlap); BAB54183|MLR7795 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (369 aa), FASTA scores: opt: 417, E(): 2.9e-19, (33.75% identity in 252 aa overlap); O64131 YOQW protein from Bacteriophage SPBc2 (224 aa), FASTA scores: opt: 413, E(): 3.4e-19, (38.5% identity in 244 aa overlap); O31916 YOQW protein from Bacillus subtilis (224 aa), FASTA scores: opt: 413, E(): 3.4e-19, (38.5% identity in 244 aa overlap); O34906 YOAM protein from Bacillus subtilis (227 aa), FASTA scores: opt: 401, E(): 2e-18, (37.7% identity in 244 aa overlap); Q9K4A5|SC7E4.11 hypothetical 30.8 KDA protein from Streptomyces coelicolor (271 aa), FASTA scores: opt: 383, E(): 3.3e-17, (39.6% identity in 283 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3602564 | 3603322 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3226c|Rv3226c
MCGRFAVTTDPAQLAEKITAIDEATGCGGGKTSYNVAPTDTIATVVSRHSEPDDEPTRRVRLMRWGLIPSWIKAGPGGAPDAKGPPLINARADKVATSPAFRSAVRSKRCLVPMDGWYEWRVDPDATPGRPNAKTPFFLHRHDGALLFTAGLWSVWKSYRSAPPLLSCTVITTDAVGELAEIHDRMPLLLAEEDWDDWLNPDAPPDPELLARPPDVRDIALRQVSTLVNNVRNNGPELLEPARSQPEQIQLL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
