Gene ML0804c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable transcritional regulatory protein WhiB-like WhiB1 |
Comments | ML0804c, len: 84 aa. Probable whiB1, WhiB-like regulatory protein (see citation below), highly similar to Rv3219|MTCY07D11.07c|O05847|Z95120 whiB1, WhiB-like regulatory protein from Mycobacterium (84 aa), fasta scores: E(): 4e-38, (95.2% identity in 84 aa); and CAD95337|Mb3245 from M. bovis (84 aa). Similar to Q9Z6E9|AF073300 whiB3 from Mycobacterium smegmatis fasta scores: E(): 2e-10, (43.2% identity in 81 aa); and to Q9X952 Hypothetical protein wblE from Streptomyces coelicolor (85 aa), fasta scores: E(): 2.3e-29, (72.840% identity in 81 aa overlap). Also similar to ML0382, ML0639, ML0760 and ML2307 |
Functional category | Regulatory proteins |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 953667 | 953921 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0804c|whiB1 MDWRHKAVCRDEDPELFFPVGNSGPAIAQIADAKLVCNRCPVTTECLAWALNTGQDSGVWGGMSEDERRALKRRNTRTKARSGV
Bibliography
No article yet recorded