Gene Rv3219 (whmE)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Transcriptional regulatory protein WhiB-like WhiB1. Contains [4FE-4S]2+ cluster. |
| Comments | Rv3219, (MTCY07D11.07c), len: 84 aa. WhiB1 (alternate gene name: whmE), WhiB-like regulatory protein (see Hutter and Dick, 1999), similar to WhiB paralogue of Streptomyces coelicolor. Equivalent to Q9CCH7|WHIB1|ML0804 putative transcriptional regulator from Mycobacterium leprae (84 aa), FASTA scores: opt: 580, E(): 3.5e-35, (95.25% identity in 84 aa overlap). Highly similar to several e.g. Q9X952|WBLE developmental regulatory protein WhiB-paralog from Streptomyces coelicolor (85 aa), FASTA scores: opt: 477, E(): 9.2e-28, (75.3% identity in 81 aa overlap); Q9AD55|SCP1.95 putative regulatory protein from Streptomyces coelicolor (102 aa), FASTA scores: opt: 383, E(): 6.1e-21, (60.75% identity in 79 aa overlap); Q9K4K8|SC5F8.16c from Streptomyces coelicolor (83 aa), FASTA scores: opt: 346, E(): 2.5e-18, (54.75% identity in 84 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Transcriptomics | DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Attempts to delete whiB1|Rv3219 from M. tuberculosis H37Rv were unsuccessful, unless whiB1 was present on a plasmid (See Smith et al., 2010). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3595713 | 3595967 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3219|whiB1
MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWALNTGQDSGVWGGMSEDERRALKRRNARTKARTGV
Bibliography
- Hutter B and Dick T [1999]. Molecular genetic characterisation of whiB3, a mycobacterial homologue of a Streptomyces sporulation factor. Homolog Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rickman L, Scott C, Hunt DM, Hutchinson T, Menendez MC, Whalan R, Hinds J, Colston MJ, Green J and Buxton RS [2005]. A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor. Transcriptome
- Agarwal N et al. [2006]. Regulation of the expression of whiB1 in Mycobacterium tuberculosis: role of cAMP receptor protein. Regulon
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Smith LJ et al. [2010]. Mycobacterium tuberculosis WhiB1 is an essential DNA-binding protein with a nitric oxide-sensitive iron-sulfur cluster. Mutant Regulon
- Stapleton M et al. [2010]. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. Regulon
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
