Gene ML0806
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | probable conserved integral membrane protein |
Comments | ML0806, len: 173 aa. Probable conserved integral membrane protein, highly similar but longer at the N terminus to Rv3217c|MTCY07D11.09|O05849|Z95120 conserved integral membrane protein from Mycobacterium tuberculosis (143 aa), fasta scores: E(): 1.3e-38, (77.1% identity in 140 aa); and CAD95335|Mb3243c from M. bovis (143 aa). Also similar to others e.g. Q9F3L9|2SC7G11.04 Putative integral membrane protein from Streptomyces coelicolor (152 aa), fasta scores: E(): 2.6e-05, (36.207% identity in 116 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 955208 | 955729 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0806|ML0806 VDRVIALLSSGAIVGPCDYADVVTLPHKRAVFSRAPAAVRGAGLIVVVQGAVALVVAAALVVRGLTGADQRIVNGLGTAIWFVVVGVAVLAAGCALLVGKRWGRGLAVFTQLLLLPVAWYLVVGSHQSAFGFPMGIVALIALILLFSPPAVRWSAGAYQRSVASSANRKADSR
Bibliography
No article yet recorded