Gene Rv3217c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv3217c, (MTCY07D11.09), len: 143 aa. Probable conserved integral membrane protein, equivalent (highly similar but shorter 30 aa) to Q9CCH6|ML0806 putative membrane protein from Mycobacterium leprae (173 aa). Also similar to others e.g. Q9F3L9|2SC7G11.04 putative integral membrane protein from Streptomyces coelicolor (152 aa), FASTA scores: opt: 177, E(): 0.00024, (33.8% identity in 136 aa overlap). And shows similarity to O34238|MVIN|VC0680 virulence factor MVIN homolog from Vibrio (525 aa), FASTA scores: opt: 126, E(): 0.97, (30.9% identity in 68 aa overlap). First GTG taken. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Cell wall and cell processes |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3593804 | 3594235 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3217c|Rv3217c
VPVRAPAAVRGAGLIVAVQGGAALVVAAALLVRGLAGADQHIVNGLGTAGWFVLVGGAVLAAGCRLAVGKLWGRGLAVFAQLLLLPVAWYLIVGSHQPAIGIPVGIIALGVLVLLFSPPSIRWAAGRDQRGAASAANRGPDSR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
