Gene ML0813c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible membrane protein |
| Comments | ML0813c, len: 195 aa. Possible membrane protein. Similar to Rv3209|MTCY07D11.17c|O05857|Z95120 Mycobacterium tuberculosis Conserved hypothetical thr-, pro-rich protein (186 aa), fasta scores: E(): 8.5e-23, (58.4% identity in 185 aa) and to Rv2198c|MTCY190.09c|MMS3_MYCTU|Q10390 Mycobacterium tuberculosis putative membrane protein mmpS3 (299 aa) fasta scores: E(): 9.4e-08, 31.0% identity in 203 aa. Also similar to ML0431 and ML0877 from M. leprae. Contains N-terminal hydrophobic region. |
| Functional category | Cell wall and cell processes, Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 962710 | 963297 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0813c|ML0813c
MRLTETTSIRRTTTTSYSGHPIVDGRQVAALLGSVAALCAIATAVIINSGDNATTKAIVGAPTPRPVLTTPSIPLPATPSSTPPLLLLPDTATATIPHKAAPPALHPRTVVYNVTGMKELLDLVTVVYTDARGYPKTEFNVVLPWTKAVVLNLGVKTQSVVATSFHSQLHCSIVNAEGQPVVASTNNAVIATCTR
Bibliography
No article yet recorded