Gene Rv3209
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical threonine and proline rich protein |
| Comments | Rv3209, (MTCY07D11.17c), len: 186 aa. Conserved hypothetical thr-, pro-rich protein, equivalent (but shorter 36 aa in N-terminus) to Q9CCH2|ML0813 putative membrane protein from Mycobacterium leprae (195 aa), FASTA scores: opt: 508, E(): 1.4e-15, (58.4% identity in 185 aa overlap). Also some similarity with Q10390|MMS3_MYCTU|MMPS3|Rv2198c|MT2254|MTCY190.09c probable conserved transmembrane transport protein from M. tuberculosis (299 aa), FASTA scores: opt: 339, E(): 3.7e-08, (35.0% identity in 180 aa overlap); and Q9CCE9|MMPS3|ML0877 putative membrane protein from Mycobacterium leprae (293 aa), FASTA scores: opt: 272, E(): 2.8e-05, (36.4% identity in 173 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3586274 | 3586834 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3209|Rv3209
VALGAVATAVIINSGDSTSTKAIVGAPAPRTVISTSPRPTAPTSTSPHPSPSTLRPQLPPETVTTVAPPGTGPTTVPTRTPTAAPPQTAVPPPAPLNPRTVVYRVTGTKQLFDLVNVVYTDARGFPVTDFNVSLPWTKMVVLNPGVQTESVVATSLYSRLNCSIVNTGAQTVVASTNNAIIATCTR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
