Gene ML0865
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable aminomethyltransferase GcvT (Glycine cleavage system T protein) |
| Comments | ML0865, len: 367 aa. Probable gcvT, aminomethyltransferase (EC 2.1.2.10). Similar to Mycobacterium tuberculosis probable aminomethyltransferase gcvT or Rv2211c or MTCY190.22 SW:GCST_MYCTU (Q10376) (379 aa) fasta scores: E(): 0, 84.7% identity in 367 aa. Similar to many e.g. Escherichia coli aminomethyltransferase gcvT SW:GCST_ECOLI (P27248) (363 aa) fasta scores: E(): 0, 39.0% identity in 364 aa. Previously sequenced as TR:O32955 (EMBL:Z98741). Contains Pfam match to entry PF01571 GCV_T, Glycine cleavage T-protein (aminomethyl transferase). Belongs to the gcvT family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1029024 | 1030127 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0865|gcvT
VTDAPELLKGPLEDRHRELGANFAEFGGWLMPVSYAGTVSEHSATRNAVGLFDVSHLGKALVRGPGAAQFVNSVLTNDLGRIRPGKAQYTLCCSESGGVIDDLIAYYVDDDEIFLVSNAANTAAVVDALQAVVPAGLTIINQHRSHAVLAVQGPRSTDVLGELGLPTGIDYMGYVDASYAGVPVRVCRTGYTGEQGYELLPPWESADVVFDALVAAVVDARGEPAGLGARDTLRTEMGYPLYGHELSLDISPLQARCGWAIGWKKDAFLGRDALLAEKAAGPRRLLRGLRMAGRGVLRPGLTVCAGDIPIGVTTSGTFSPTLQVGVALALIDSEAAVQDGQQIIVDVRGRAVECEVVRPPFIEVKTR
Bibliography
No article yet recorded