Gene Rv2211c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The glycine cleavage system catalyzes the degradation of glycine [catalytic activity: (6S)-tetrahydrofolate + S-aminomethyldihydrolipoylprotein = (6R)-5,10-methylenetetrahydrofolate + NH3 + dihydrolipoylprotein]. |
| Product | Probable aminomethyltransferase GcvT (glycine cleavage system T protein) |
| Comments | Rv2211c, (MTCY190.22), len: 379 aa. Probable gcvT, aminomethyltransferase, similar to many e.g. GCST_ECOLI|P27248 for Escherichia coli (38.2% identity in 364 aa overlap); etc. Belongs to the GcvT family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2476042 | 2477181 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2211c|gcvT
VCQQGRPLGWDAVSDVPELIHGPLEDRHRELGASFAEFGGWLMPVSYAGTVSEHNATRTAVGLFDVSHLGKALVRGPGAAQFVNSALTNDLGRIGPGKAQYTLCCTESGGVIDDLIAYYVSDDEIFLVPNAANTAAVVGALQAAAPGGLSITNLHRSYAVLAVQGPCSTDVLTALGLPTEMDYMGYADASYSGVPVRVCRTGYTGEHGYELLPPWESAGVVFDALLAAVSAAGGEPAGLGARDTLRTEMGYPLHGHELSLDISPLQARCGWAVGWRKDAFFGRAALLAEKAAGPRRLLRGLRMVGRGVLRPGLAVLVGDETVGVTTSGTFSPTLQVGIGLALIDSDAGIEDGQQINVDVRGRAVECQVVCPPFVAVKTR
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant