Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThe glycine cleavage system catalyzes the degradation of glycine [catalytic activity: (6S)-tetrahydrofolate + S-aminomethyldihydrolipoylprotein = (6R)-5,10-methylenetetrahydrofolate + NH3 + dihydrolipoylprotein].
ProductProbable aminomethyltransferase GcvT (glycine cleavage system T protein)
CommentsRv2211c, (MTCY190.22), len: 379 aa. Probable gcvT, aminomethyltransferase, similar to many e.g. GCST_ECOLI|P27248 for Escherichia coli (38.2% identity in 364 aa overlap); etc. Belongs to the GcvT family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS24760422477181-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2211c|gcvT
VCQQGRPLGWDAVSDVPELIHGPLEDRHRELGASFAEFGGWLMPVSYAGTVSEHNATRTAVGLFDVSHLGKALVRGPGAAQFVNSALTNDLGRIGPGKAQYTLCCTESGGVIDDLIAYYVSDDEIFLVPNAANTAAVVGALQAAAPGGLSITNLHRSYAVLAVQGPCSTDVLTALGLPTEMDYMGYADASYSGVPVRVCRTGYTGEHGYELLPPWESAGVVFDALLAAVSAAGGEPAGLGARDTLRTEMGYPLHGHELSLDISPLQARCGWAVGWRKDAFFGRAALLAEKAAGPRRLLRGLRMVGRGVLRPGLAVLVGDETVGVTTSGTFSPTLQVGIGLALIDSDAGIEDGQQINVDVRGRAVECQVVCPPFVAVKTR