Gene ML0892
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable 1-acylglycerol-3-phosphate O-acyltransferase |
| Comments | ML0892, len: 244 aa. Probable 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51). Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:O69572 (EMBL:AL022602) (244 aa), Fasta scores: E(): 0, 100.0% identity in 244 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv2182c TR:O53516 (EMBL:AL021957) (247 aa), Fasta scores: E(): 0, 79.8% identity in 247 aa overlap and several Streptomyces coelicolor putative acyltransferases e.g. TR:CAB76086 (EMBL:AL157956) (223 aa), Fasta scores: E(): 0, 51.1% identity in 221 aa overlap. Contains Pfam match to entry PF01553 Acyltransferase, Acyltransferase. |
| Functional category | Intermediary metabolism and respiration, Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1057966 | 1058700 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0892|ML0892
MWYWLFKYIFMGPALSVLGRPKVEGLEYVPSSGPAILASNHLAVADSFYLPLVVRRRITFLAKSEYFTGTGLKGWFTSWFYRATGQVPIDRTDADTAEAALNTAERLLGHGKLIGMYPEGTRSPDGRLYKGKTGVARLTLQTGVPVIPVAMIGTNVVNPPGSKMWRFGRVTVRFGKPMDFSRFEGAAGNRVIERVITDEVIYELMELSGQEYVDIYAASVKGHSSSSGAKLTNEAVRIPDTAVG
Bibliography
No article yet recorded