Gene Rv2182c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Transfer of fatty acyl groups |
| Product | 1-acylglycerol-3-phosphate O-acyltransferase |
| Comments | Rv2182c, (MTV021.15c), len: 247 aa. Probable 1-acylglycerol-3-phosphate O-acyltransferase, similar to many e.g. in Streptomyces. Contains PS00017 ATP/GTP-binding site motif A (P-loop). FASTA scores: pir||T35503 1-acylglycerol-3-phosphate O-acyltransferase homolog SC6E10.16c - Streptomyces coelicolor >gi|5689932|emb|CAB51970.1| (AL109661) hypothetical protein [Streptomyces coelicolor A3(2)] Length = 262, Expect = 6e-61 (54% identity in 215 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2444586 | 2445329 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2182c|Rv2182c
MWYYLFKYIFMGPLFTLLGRPKVEGLEYIPSSGPAILASNHLAVADSFYLPLVVRRRIWFLAKSEYFTGTGLKGWINRWFYSVSGQVPIDRTNADSAQGALQTAVVLLGQGKLLGMYPEGTRSPDGRLYKGKTGLARLALHTGVPVIPVAMIGTNVVNPPGRKMLRFGRVTVRFGKPMDFSRFEGLAGNHFIERAVTDEVIYELMGLSGQEYVDIYAASVKDGRNAGGAGANPNSTDAARIPETAAG
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
