Gene ML0903c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0903c, len: 210 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:O69563 (EMBL:AL022602) (210 aa), Fasta scores: E(): 0, 99.5% identity in 210 aa overlap. Also highly similar to another protein of undefined function from Mycobacterium tuberculosis TR:O53504 (EMBL:AL021957) (206 aa), Fasta scores: E(): 0, 76.7% identity in 210 aa overlap. |
| Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1069305 | 1069937 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0903c|ML0903c
LAIFLINLSPNEMERRLNEALEVYVDAMRYPRNTENLRAGIWLEHIRRPGWQAVAAVEVRIEVADVADMADGPAHPAPSADELNNAPLRGVAYGYPGAPGQWWQQQVVQGLQRSGLSTLEIARLMNSYFELTELHIHPHTQGRGIGEALTRRLLAHRRENNVLLSTPETNGETNRAWRLYRRLGFMDIIRRHYFAGDPRAFAILGRTLPL
Bibliography
No article yet recorded