Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionAcetylation, substrate unknown
ProductGCN5-related N-acetyltransferase
CommentsRv2170, (MTV021.03), len: 206 aa. Probable acetyltransferase. Contains GNAT (Gcn5-related N-acetyltransferase) domain in C-terminal part. See Vetting et al. 2005. Equivalent to hypothetical protein ML0903 (210 aa) from Mycobacterium leprae. FASTA scores: ML0903 conserved hypothetical protein (210 aa) opt: 1045, E(): 9.1e-57; 77.143% identity in 210 aa overlap. >emb|CAA18679.1| (AL022602) >gi|13092973|emb|CAC31284.1| (AL583920). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS24322352432855+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2170|Rv2170
LAIFLIDLPPSDMERRLGDALTVYVDAMRYPRGTETLRAPMWLEHIRRRGWQAVAAVEVTAAEQAEAADTTALPSAAELSNAPMLGVAYGYPGAPGQWWQQQVVLGLQRSGFPRLAIARLMTSYFELTELHILPRAQGRGLGEALARRLLAGRDEDNVLLSTPETNGEDNRAWRLYRRLGFTDIIRGYHFAGDPRAFAILGRTLPL