Gene ML0986
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0986, len: 67 aa. Conserved hypothetical protein. Highly similar to proteins of undefined function from Mycobacterium tuberculosis Rv2738c TR:O33281 (EMBL:AL008967) (68 aa), Fasta scores: E(): 7.9e-24, 85.1% identity in 67 aa overlap and Streptomyces coelicolor TR:O50484 (EMBL:AL020958) (64 aa), Fasta scores: E(): 2.5e-08, 44.4% identity in 63 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1152705 | 1152908 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0986|ML0986
LAGVRLTEFHERVVLRFGAAYGASVLVDHVLTGFDGRTVAQAIEDGVELRDVWRALCVDFDVPRDQW
Bibliography
No article yet recorded