Gene Rv2738c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2738c, (MTV002.03c), len: 68 aa. Conserved hypothetical protein, equivalent to Q9CCC1|ML0986 hypothetical protein from Mycobacterium leprae (67 aa), FASTA scores: opt: 397, E(): 3.7e-22, (83.6% identity in 67 aa overlap). Also highly similar to O50484|SC4H8.05 hypothetical 7.5 KDA protein from Streptomyces coelicolor (64 aa), FASTA scores: opt: 185, E(): 5.9e-07, (39.7% identity in 63 aa overlap). Second part of the protein is highly similar to C-terminus of upstream ORF O33285|Rv2742c|MTV002.07c conserved hypothetical protein from Mycobacterium tuberculosis (277 aa), FASTA scores: opt: 200, E(): 1.7e-07, (78.4% identity in 37 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3051806 | 3052012 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2738c|Rv2738c
MLAGVRLTEFHERVALHFGAAYGSSVLLDHVLTGFDGRSAAQAIEDGVEPRDVWRALCADFDVPHDRW
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
