Gene ML1004
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible conserved membrane protein |
| Comments | ML1004, len: 164 aa. Possible conserved membrane protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49846 (EMBL:U00019) (164 aa), Fasta scores: E(): 0, 100.0% identity in 164 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv2719c TR:O07218 (EMBL:Z96072) (165 aa), Fasta scores: E(): 1.8e-23, 55.2% identity in 163 aa overlap. Contains a possible membrane spanning hydrophobic domain. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1176011 | 1176505 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1004|ML1004
MLVIYAVPPLIGNVRHPMSRPILGPRCGSGESAGSRRPAPSRSASAPMRYSGASVAMLVAPHRGRTVSLAKTIGLALLAGMITLWLGLMADVSQVIDGDATGFVTHVPNRLAVVRVEAGESLQDVAARVAPDAPVRQVSERIRELNVLDSSMLVAGQTLIAPVG
Bibliography
No article yet recorded