Gene ML1005
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1005, len: 154 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49844 (EMBL:U00019) (154 aa), Fasta scores: E(): 0, 100.0% identity in 154 aa overlap. Also highly similar to a number of other proteins of unknown function e.g. Mycobacterium tuberculosis Rv2718c TR:O07217 (EMBL:Z96072) (154 aa), Fasta scores: E(): 0, 92.7% identity in 151 aa overlap and Escherichia coli SW:YBAD_ECOLI (P25538) (149 aa), Fasta scores: E(): 9.7e-21, 45.6% identity in 147 aa overlap. Belongs to the UPF0168 family. |
| Functional category | Conserved hypotheticals, Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1176667 | 1177131 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1005|ML1005
MHCPFCRHSDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETAVVAVVKRSGVTEPFSRGKVIRGVRRACQGRQVDDDALNLLAQQVEDTVRAAGLPEVPSHEVGLAILGPLRELDEVAYLRFASVYRSFSSADDFEREIEALRAHRRVSTSR
Bibliography
No article yet recorded