Gene Rv2718c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism |
| Product | Probable transcriptional regulatory protein NrdR |
| Comments | Rv2718c, (MTCY05A6.39c), len: 154 aa. Probable nrdR, transcriptional regulatory protein, equivalent to Q49844|ML1005|U2235A|B2235_C2_209 hypothetical 17.3 KDA protein from Mycobacterium leprae (154 aa), FASTA scores: opt: 937, E(): 1.5e-52, (92.7% identity in 151 aa overlap). Highly similar to O86848|NRDR_STRCL putative regulatory protein from Streptomyces clavuligerus (172 aa), FASTA scores: opt: 750, E(): 1.1e-40, (73.65% identity in 148 aa overlap); O69980|SC4H2.25 hypothetical protein from Streptomyces coelicolor (182 aa), FASTA scores: opt: 725, E(): 4.6e-39, (73.1% identity in 145 aa overlap); Q9KPU0|VC2272 hypothetical protein from Vibrio cholerae (156 aa), FASTA scores: opt: 462, E(): 1.8e-22, (47.3% identity in 148 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv nrdR|Rv2718c mutant has increased expression of nrdE|Rv3051c and nrdF2|Rv3048c (See Mowa et al., 2009). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3030413 | 3030877 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2718c|nrdR
MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVKRSGVTEPFSREKVISGVRRACQGRQVDDDALNLLAQQVEDSVRAAGSPEIPSHDVGLAILGPLRELDEVAYLRFASVYRSFSSADDFAREIEALRAHRNLSAHS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Mowa MB, Warner DF, Kaplan G, Kana BD and Mizrahi V [2009]. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
