Gene ML1023c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable polyphosphate glucokinase PpgK (POLYPHOSPHATE-GLUCOSE PHOSPHOTRANSFERASE) |
| Comments | ML1023c, len: 324 aa. Probable ppgK, polyphosphate glucokinase (EC 2.7.1.63). Identical to the previously sequenced Mycobacterium leprae polyphosphate glucokinase (EC 2.7.1.63) SW:PPGK_MYCLE (Q49988) (324 aa), Fasta scores: E(): 0, 99.7% identity in 324 aa overlap catalysing the phosphorylation of glucose thereby generating D-glucose 6-phosphate. Also highly similar to Mycobacterium tuberculosis Rv2702 SW:PPGK_MYCTU (Q59568) (265 aa), Fasta scores: E(): 0, 82.8% identity in 262 aa overlap. Note the predicted translational start site for this CDS maybe incorrect due to the overlap with CDS ML1024. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1190923 | 1191897 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1023c|ppgK
VIRLRSAAARDRCQVLSLAYRITVAGRCQTVSPHHRQAKVSEQPSLAKEIAITSTDATADTPRTSPPSDTAGTTSRHRGFGIDIGGSSIKGGIVDLDIGQLIGDRIKLLTPQPATPLAVAKTIAEVVNAFGWTAPLGVTYPGVVTQGVVRTAANVDDSWIGTNARDIISAELNSQEVTILNDADAAGLAEGRYGAGKNNSGLIVLLTFGTGIGSAVIHNGKLIPNTEFGHLEVDGKEAEQRAASSVKDKYKWSYRTWAKQVTRVLVAIENAMCPDLFIAGGGISRKADRWIPLLENRTPMVAAALQNTAGIVGAAMASTADVTH
Bibliography
No article yet recorded