Gene Rv2702
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Catalyzes the phosphorylation of glucose using polyphosphate or ATP as the phosphoryl donor. GTP, UTP and CTP can replace ATP as phosphoryl donor [catalytic activity: (phosphate)(N) + D-glucose = (phosphate)(N-1) + D-glucose 6-phosphate]. |
| Product | Polyphosphate glucokinase PpgK (polyphosphate-glucose phosphotransferase) |
| Comments | Rv2702, (MTCY05A6.23), len: 265 aa. PpgK, polyphosphate glucokinase (see citations below), equivalent, but shorter 60 aa, to Q49988|PPGK_MYCLE|ML1023|U1764FG polyphosphate glucokinase from Mycobacterium leprae (324 aa), FASTA scores: opt: 1411, E(): 5.6e-80, (82.8% identity in 262 aa overlap). Also highly similar (or just similar) to others e.g. Q9ADE8|PPGK from Streptomyces coelicolor (246 aa), FASTA scores: opt: 912, E(): 3e-49, (57.3% identity in 239 aa overlap); Q9AGV8|PPGK from Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) (277 aa), FASTA scores: opt: 890, E(): 7.5e-48, (57.75% identity in 239 aa overlap); P40184|GLK_STRCO|SC6E10.20c from Streptomyces coelicolor (317 aa), FASTA scores: opt: 233, E(): 3.2e-07, (31.3% identity in 163 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain and no virulence modification seen in SCID mice (see McAdam et al., 2002). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3016858 | 3017655 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2702|ppgK
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAVAKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTILNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAEERAASSVKEKNDWTYPKWAKQVIRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTPVVPAALQNTAGIVGAAMASVADTTH
Bibliography
- Hsieh PC et al. [1996]. Cloning, expression, and characterization of polyphosphate glucokinase from Mycobacterium tuberculosis. Sequence Product Biochemistry
- Hsieh PC et al. [1996]. Kinetic mechanisms of polyphosphate glucokinase from Mycobacterium tuberculosis. Biochemistry
- Mulder MA et al. [1997]. Mycobacterial promoters. Review Regulation
- McAdam RA, Quan S, Smith DA, Bardarov S, Betts JC, Cook FC, Hooker EU, Lewis AP, Woollard P, Everett MJ, Lukey PT, Bancroft GJ, Jacobs Jr WR and Duncan K [2002]. Characterization of a Mycobacterium tuberculosis H37Rv transposon library reveals insertions in 351 ORFs and mutants with altered virulence. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
