Gene ML1040c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | ML1040c, len: 429 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q50004 (EMBL:U15181) (429 aa), Fasta scores: E(): 0, 100.0% identity in 429 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv2681 TR:O07183 (EMBL:Z96072) (438 aa), Fasta scores: E(): 0, 77.4% identity in 416 aa overlap. The predicted product of this CDS is also weakly similar to several nucleases e.g. Escherichia coli SW:RND_ECOLI (P09155) (375 aa), Fasta scores: E(): 2.4e-08, 26.7% identity in 371 aa overlap ribonuclease D (EC 3.1.26.3). Contains Pfam match to entry PF01612 3_5_exonuclease, 3'-5' exonuclease. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1205250 | 1206539 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1040c|ML1040c MREPADDQPGGTEPDPTPLHYPAGGIPNLSVTPSEIAAAAERLDQGYGPFAVDTERASGFRYSNRAYLIQIRRANAGTVLIDPVSHGNDPLTALRPVAEVISKDEWILHSADQDLPCLAEVGMRPPALYDTELAGRLAGFDRVNLATMVQRLLGFELAKGHGAADWSKRPLPSDWLNYAALDVELLIELRTAISKVLAEQDKTDWATQEFNYLRTYATRGATTETIPPTRRDRWRRTSGIRRVRDRRALAAVRELWATRDHIAQRRDIAPRRILPDTAIIDAAIADPKTIDELIAMPVFGGANQRRSAAMWLAALETARQSQDLPDEAEPSNVPPPPGRWARRKPDAAARLEAARAALATVSQRVGVPTENLVSPELVRRLCWDWEVLPESSVDPVNAVEEYLRVGQARAWQRELVVTILASAVKSSAG
Bibliography
No article yet recorded