Gene ML1064
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1064, len: 326 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49955 (EMBL:U15180) (318 aa), Fasta scores: E(): 0, 100.0% identity in 317 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv1208 TR:O05309 (EMBL:Z93777) (324 aa), Fasta scores: E(): 0, 79.8% identity in 327 aa overlap. |
| Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1229651 | 1230631 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1064|gpgS
MTASELIASALAARSGDAWLADRSWSRPAWTIDELVAAKAGRAISVVLPALNEEQTIESVIDSISPLVSDRAGLVDELIVLDSGSTDETEIRAIAAGARVVSCEQAMPEVPTRPGKGEALWRSLAVTSGDIVVFVDSDLINPHPMFVPWLVGPLLTGDGIHLVKGFYRRPLNSNDAGGSARATGGGRVTELVARPLLASLRPQLGYVLQPLSGEYAATRELLTALPFAPGYGVEIGLLVDTFDRLGLDAIAQVNLGVRAHRNRPLAELGAMSRQVIATLLSRCGILDSGVGLTQFFVDESDGDGYIRHTWSVSLADRPAMSRLRPR
Bibliography
No article yet recorded