Gene Rv1208
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Glucosylglycerate biosynthesis [catalytic activity: NDP-glucose + 3-phosphoglycerate = glucosyl-3-phsophoglycerate + NDP] |
| Product | Probable glucosyl-3-phosphoglycerate synthase GpgS |
| Comments | Rv1208, (MTCI364.20), len: 324 aa. Probable gpgS, glucosyl-3-phosphoglycerate synthase (See Empadinhas et al., 2008), similar to Q49955|U1756L Mycobacterium leprae (318 aa), FASTA scores, opt: 1621, E(): 0, (80.5% identity in 318 aa overlap). Belongs to retaining glycosyltransferase family 81. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1352144 | 1353118 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1208|gpgS
MTASELVAGDLAGGRAPGALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRRPLQVSDVTSGVCATGGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLPGGPDDSDYTRHTWPVSLVDRPPMKVMRPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Fulton Z et al. [2008]. Crystal structure of a UDP-glucose-specific glycosyltransferase from a Mycobacterium species. Structure
- Empadinhas N et al. [2008]. Identification of the mycobacterial glucosyl-3-phosphoglycerate synthase. Function Product
- Gest P et al. [2008]. Preliminary crystallographic analysis of GpgS, a key glucosyltransferase involved in methylglucose lipopolysaccharide biosynthesis in Mycobacterium tuberculosis. Structure
- Pereira PJ et al. [2008]. Mycobacterium tuberculosis glucosyl-3-phosphoglycerate synthase: structure of a key enzyme in methylglucose lipopolysaccharide biosynthesis. Structure
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant