Gene ML1077
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1077, len: 139 aa. Conserved hypothetical protein. Highly similar to anti-sigma factor rseA from Mycobacterium tuberculosis Rv1222 (regulates negatively sigE), Fasta scores: E(): 0, 70.7% identity in 150 aa overlap; and Mycobacterium avium TR:O05736 (EMBL:U87308) (133 aa), Fasta scores: E(): 0, 71.7% identity in 138 aa overlap; and Mycobacterium smegmatis TR:O05768 (EMBL:U87307) (145 aa), Fasta scores: E(): 0, 66.2% identity in 139 aa overlap. |
| Functional category | Conserved hypotheticals, Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1240281 | 1240700 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1077|rseA
VMADRGQVFRRVFSWLPAQFASQNDAPVGAPRRFGSTEHLSVEAIAAFVDGELRMNAHLRAAHHISLCAQCAAEVDDQSRTRAALRDSHPIRIPSTLFGLLTAIPRCSPDYTSPVSEPFSEGSVSDRFVDGVAREQGKR
Bibliography
No article yet recorded