Gene ML1079
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable protein TatB |
Comments | ML1079, len: 120 aa. Probable TatB, component of twin-arginine translocation protein export system. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49973 (EMBL:U15180) (120 aa), Fasta scores: E(): 0, 98.3% identity in 120 aa overlap. Also highly similar to Mycobacterium tuberculosis TatB protein Rv1224 TR:O33220 (EMBL:Z98260) (131 aa), Fasta scores: E(): 0, (74.0% identity in 131 aa overlap). Also similar, in parts, to Escherichia coli TatB or MttA2, Sec-independent protein translocase, TR:O69415 (EMBL:AJ005830) (171 aa), Fasta scores: E(): 0.00022, 29.8% identity in 121 aa overlap. Contains a possible N-terminal signal sequence. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1242376 | 1242738 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1079|tatB VFANIGWGEMLVLVVVGLVVLGPERFPGAIRWTLGALRQTRDYLSGVTNQLREDIGPEFDDLRGQFGELQKLRGMTPRAALTKHLLDGDDSLFTGNFDRPAAAKQQDRDHHQTPFDTDAT
Bibliography
No article yet recorded